Structure of PDB 6n8j Chain J

Receptor sequence

>6n8jJ (length=161) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

NPMRDLKIEKLVLNISVGRLTRASKVLEQLSGQTPVQSKARYTVRTFGIR
RNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHI
DLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTV
SWFKQKYDADV

3D structure

PDB

6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K16 N20 S22 V23 G24 A50 R51 V54 F57 A66 R94 N95 S97 A98 T99 G103 F104 G105 I106 G124 D126 Y128 K142	K10 N14 S16 V17 G18 A40 R41 V44 F47 A56 R84 N85 S87 A88 T89 G93 F94 G95 I96 G114 D116 Y118 K132
BS02	rna	J	M9 R10 Q43 T44 V69 T70 R72 P134 G135 R137 R141 R143 G149 N150 H152	M3 R4 Q33 T34 V59 T60 R62 P124 G125 R127 R131 R133 G139 N140 H142

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
PDBsum	6n8j
PubMed	30814529
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]