Structure of PDB 6mxx Chain J |
>6mxxJ (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] |
MNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDI LLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYK RMAVILSLEQGNRLREQYGL |
|
PDB | 6mxx An autoinhibited state of 53BP1 revealed by small molecule antagonists and protein engineering. |
Chain | J |
Resolution | 2.298 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K6P |
J |
W1495 D1521 M1584 |
W13 D39 M102 |
BindingDB: IC50=1.3e+4nM |
|
|