Structure of PDB 6l8e Chain J |
>6l8eJ (length=59) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] |
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMME TLYLQQNPN |
|
PDB | 6l8e Distinct oligomeric structures of the YoeB-YefM complex provide insights into the conditional cooperativity of type II toxin-antitoxin system. |
Chain | J |
Resolution | 2.35 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
J |
N5 Y6 S7 R10 |
N5 Y6 S7 R10 |
|
|
|