Structure of PDB 6l35 Chain J

Receptor sequence
>6l35J (length=41) Species: 3218 (Physcomitrium patens) [Search protein sequence]
MQDVKTYLSTAPVLATLWFGFLAGLLIEINRFFPDALVLPL
3D structure
PDB6l35 Antenna arrangement and energy-transfer pathways of PSI-LHCI from the moss Physcomitrella patens.
ChainJ
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J P12 T16 F19 G20 P12 T16 F19 G20
BS02 CLA J N30 D35 A36 N30 D35 A36
BS03 CLA J W18 L22 W18 L22
BS04 CLA J G24 E28 R31 G24 E28 R31
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6l35, PDBe:6l35, PDBj:6l35
PDBsum6l35
PubMed33589616
UniProtQ6YXM2|PSAJ_PHYPA Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]