Structure of PDB 6k0b Chain J

Receptor sequence
>6k0bJ (length=116) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence]
AVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAED
VKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGD
AEELKVLIEKVNVLKQ
3D structure
PDB6k0b Cryo-electron microscopy structure of an archaeal ribonuclease P holoenzyme.
ChainJ
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J K29 G30 N32 E33 K36 V52 K53 K78 L87 V89 A91 S92 K28 G29 N31 E32 K35 V51 K52 K77 L86 V88 A90 S91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034512 box C/D sno(s)RNA binding
Biological Process
GO:0000492 box C/D snoRNP assembly
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0031428 box C/D methylation guide snoRNP complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6k0b, PDBe:6k0b, PDBj:6k0b
PDBsum6k0b
PubMed31197137
UniProtP54066|RL7A_METJA Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]