Structure of PDB 6inq Chain J |
>6inqJ (length=66) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence] |
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVL THVDLIEKFLRYNPLE |
|
PDB | 6inq Structural basis of the nucleosome transition during RNA polymerase II passage. |
Chain | J |
Resolution | 6.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C7 C44 C45 |
C7 C44 C45 |
|
|
|
|