Structure of PDB 6htq Chain J

Receptor sequence

>6htqJ (length=142) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

TPMANASTIERKWLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGD
HVIIINAEKIELTGKKLTDKIYYRHTQHPGGLKSRTALEMRTNYPEKMLE
LAIKGMLPKGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG

3D structure

• PDB: 6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
• Chain: J
• Resolution: 4.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T4 P5 A9 R14 G27 R28 S31 R38 K40 H48 L65 T66 K69 K73 Y76 R77 H78 T79 H81 K86 Y97 K100 E103 A105 G108 M109 P111 K112 S114 L115 R117 K121 H133 A135 Q136	T1 P2 A6 R11 G24 R25 S28 R35 K37 H45 L62 T63 K66 K70 Y73 R74 H75 T76 H78 K83 Y94 K97 E100 A102 G105 M106 P108 K109 S111 L112 R114 K118 H130 A132 Q133

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6htq, PDBe:6htq, PDBj:6htq
• PDBsum: 6htq
• PubMed: 32937119
• UniProt: P70974|RL13_BACSU Large ribosomal subunit protein uL13 (Gene Name=rplM)