Structure of PDB 6hb4 Chain J

Receptor sequence

>6hb4J (length=193) Species: 9606 (Homo sapiens) [Search protein sequence]

SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIK

3D structure

PDB

6hb4 DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region.

Chain

Resolution

3.05 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	J	Y103 W107	Y60 W64	PDBbind-CN: Kd=4.4nM
BS02	dna	J	K51 K52 V54 L58 K62 K69 K139 M143 R157 Y162 Q179 L182 K183 K186 W189 Y211 R232	K8 K9 V11 L15 K19 K26 K96 M100 R114 Y119 Q136 L139 K140 K143 W146 Y168 R189	PDBbind-CN: Kd=4.4nM
BS03	dna	J	S55 Y57 T78 I81 R82 A85 W88 R89 K136 K139 R140 K146 K156 R157 R159 N163 V166 A167 P178	S12 Y14 T35 I38 R39 A42 W45 R46 K93 K96 R97 K103 K113 R114 R116 N120 V123 A124 P135	PDBbind-CN: Kd=4.4nM

External links

PDB	RCSB:6hb4, PDBe:6hb4, PDBj:6hb4
PDBsum	6hb4
PubMed	31114891
UniProt	Q00059\|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]