Structure of PDB 6fyy Chain J

Receptor sequence

>6fyyJ (length=182) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

PRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLE
SEKHIDFARTSPFGGARPGRVARKRAAAAGGE

3D structure

• PDB: 6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
• Chain: J
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	P2 R3 P5 R6 T7 Y8 S9 K10 T11 Y12 T14 K16 R17 P18 Y19 L24 K37 N38 K39 R40 R44 S50 R53 R54 K65 F71 E72 A75 R78 R79 R82 K120 S121 H124 R126 V127 Q131 R132 H133 Q139 V141 N142 I143 P144 S145 F146 M147 V148 R149 S152 P163 F164 R168 P169 G170 R171 V172 A173 K175 R176	P1 R2 P4 R5 T6 Y7 S8 K9 T10 Y11 T13 K15 R16 P17 Y18 L23 K36 N37 K38 R39 R43 S49 R52 R53 K64 F70 E71 A74 R77 R78 R81 K119 S120 H123 R125 V126 Q130 R131 H132 Q138 V140 N141 I142 P143 S144 F145 M146 V147 R148 S151 P162 F163 R167 P168 G169 R170 V171 A172 K174 R175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
• PDBsum: 6fyy
• PubMed: 30475211
• UniProt: Q6CM18