Structure of PDB 6edt Chain J

Receptor sequence

>6edtJ (length=109) Species: 1773 (Mycobacterium tuberculosis)

DRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPG
TWLCRNGMEGTLIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERL
ELIRSRRRG

3D structure

• PDB: 6edt Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
• Chain: J
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	J	R4 V5 L6	R2 V3 L4

Gene Ontology

Molecular Function

• GO:0001000 bacterial-type RNA polymerase core enzyme binding
• GO:0001108 bacterial-type RNA polymerase holo enzyme binding
• GO:0003676 nucleic acid binding
• GO:0005515 protein binding

Biological Process

• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:6edt, PDBe:6edt, PDBj:6edt
• PDBsum: 6edt
• PubMed: 30626968
• UniProt: P9WHJ5|RBPA_MYCTU RNA polymerase-binding protein RbpA (Gene Name=rbpA)