Structure of PDB 6drd Chain J |
>6drdJ (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] |
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL AHVDLIEKLLNYAP |
|
PDB | 6drd Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1. |
Chain | J |
Resolution | 3.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C44 C45 |
C44 C45 |
|
|
|
|