Structure of PDB 6ddd Chain J

Receptor sequence
>6dddJ (length=59) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
GKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSA
RALKSGKVT
3D structure
PDB6ddd cryoEM-Guided Development of Antibiotics for Drug-Resistant Bacteria.
ChainJ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J G2 K3 R10 S13 T14 N16 R18 S19 A21 L22 N23 K26 R27 R28 W29 N30 A31 N32 Q34 K43 K46 A51 R52 K55 G1 K2 R9 S12 T13 N15 R17 S18 A20 L21 N22 K25 R26 R27 W28 N29 A30 N31 Q33 K42 K45 A50 R51 K54
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ddd, PDBe:6ddd, PDBj:6ddd
PDBsum6ddd
PubMed30667174
UniProtQ2FZ60|RL28_STAA8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]