Structure of PDB 6bok Chain J

Receptor sequence
>6bokJ (length=146) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEAR
IRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEA
LSRQHGITIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVA
3D structure
PDB6bok Conformational Control of Translation Termination on the 70S Ribosome.
ChainJ
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J K22 Y25 N28 Y29 R33 S42 K45 L47 R50 K22 Y25 N28 Y29 R33 S42 K45 L47 R50
BS02 MG J L116 E117 L116 E117
BS03 MG J A115 L128 A115 L128
BS04 MG J K118 K121 Y126 K118 K121 Y126
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum6bok
PubMed29731232
UniProtQ72GV5|RL9_THET2 Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]