Structure of PDB 6bo7 Chain J

Receptor sequence

>6bo7J (length=218) Species: 5855 (Plasmodium vivax)

KIPNNPGAGENALEPIYIKDDDGYDIDTFLIPDHYKNYITKVLIPNGVLK
NRIEKLAFDIKQVYRNEEFHVICLLKGSRGFFSALLKYLNRIHNYSSTES
PKHLYVEHYVRVKSIEIVSEDLSCLKDKHVLIVEDIIDTGKTLLKFCEYL
KKFEVKTIAITCLFIKRTPLWNGFKADFVGFSIPDAFVVGYSLDYNEKFR
DLDHLCLVNDEGIKKFRT

3D structure

• PDB: 6bo7 Design of Plasmodium vivax Hypoxanthine-Guanine Phosphoribosyltransferase Inhibitors as Potential Antimalarial Therapeutics.
• Chain: J
• Resolution: 2.856 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E144 D145 D148 F197 R210
• Catalytic site (residue number reindexed from 1): E134 D135 D138 F187 R200
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	J	E144 D145	E134 D135
BS02	YPG	J	I146 D148 T149 G150 T152 K176 F197 V198 D204	I136 D138 T139 G140 T142 K166 F187 V188 D194

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6bo7, PDBe:6bo7, PDBj:6bo7
• PDBsum: 6bo7
• PubMed: 29161011
• UniProt: A5K7E9