Structure of PDB 6a5t Chain J

Receptor sequence
>6a5tJ (length=66) Species: 644223 (Komagataella phaffii GS115) [Search protein sequence]
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVL
THVDLIEKFLRYNPLE
3D structure
PDB6a5t Structural basis of the nucleosome transition during RNA polymerase II passage.
ChainJ
Resolution6.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN J C7 C44 C45 C7 C44 C45
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006383 transcription by RNA polymerase III
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005736 RNA polymerase I complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6a5t, PDBe:6a5t, PDBj:6a5t
PDBsum6a5t
PubMed30287617
UniProtC4R009

[Back to BioLiP]