Structure of PDB 5zwm Chain J

Receptor sequence

>5zwmJ (length=304) Species: 559292 (Saccharomyces cerevisiae S288C)

LQKQQEEEELKRKLKQEEDEKDKRKLIESGPNLELHEDKFLLDLSKFKIY
YDNNHGYEWWDTAYLVAHPLPEKIIKAYLTQHERKRLRRNRRKMAREARE
IKIKLGLLPKPEPKVKLSNMMSVFENDQNITDPTAWEKVVKDQVDLRKRK
HLEENERRHEDAIKRRKEAVNMNVEKPTVYHCKVFQFKNLQNPKIRFKLK
MNSKELSLKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFE
LHIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEH
FYSP

3D structure

• PDB: 5zwm Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
• Chain: J
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K242 R246 R253 K271 N276 S279 N312 R315 H316 P350 K351 R353 F354 K355 M358 E362 N394 R399 F441 M442	K85 R89 R96 K114 N119 S122 N155 R158 H159 P193 K194 R196 F197 K198 M201 E205 N237 R242 F279 M280
BS02	rna	J	R241 R245 R246 R249 K273 K305 H308	R84 R88 R89 R92 K116 K148 H151

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000387 spliceosomal snRNP assembly
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005687 U4 snRNP
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP

External links

• PDB: RCSB:5zwm, PDBe:5zwm, PDBj:5zwm
• PDBsum: 5zwm
• PubMed: 29794219
• UniProt: Q03338|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 (Gene Name=PRP3)