Structure of PDB 5zgb Chain J

Receptor sequence
>5zgbJ (length=38) Species: 280699 (Cyanidioschyzon merolae strain 10D) [Search protein sequence]
MNLKKYLSTAPVVATLWLFLTAGILIELNRFFPDSLFY
3D structure
PDB5zgb Unique organization of photosystem I-light-harvesting supercomplex revealed by cryo-EM from a red alga
ChainJ
Resolution3.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J V13 L16 W17 V13 L16 W17
BS02 CLA J W17 L18 L25 W17 L18 L25
BS03 CLA J A10 P11 T15 L18 F19 A10 P11 T15 L18 F19
BS04 CLA J N29 S35 L36 N29 S35 L36
BS05 CLA J E27 R30 F31 E27 R30 F31
BS06 3XQ J S35 F37 Y38 S35 F37 Y38
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zgb, PDBe:5zgb, PDBj:5zgb
PDBsum5zgb
PubMed29632169
UniProtQ85FS8|PSAJ_CYAM1 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]