Structure of PDB 5us6 Chain J

Receptor sequence

>5us6J (length=267) Species: 216895 (Vibrio vulnificus CMCP6)

GMVRIAVAGAAGRMGRNLVKAAHHNPVAKVAAGSERPESSLVGVDLGELC
GEGKFDVVVCDDLAKQIDQFDVIIDFTAPASTLNNLALCQQYGKSIVIGT
TGFTEEQREQIDLVAQQVPVVMAPNYSVGVNLVFKLLEKAAKVMGDYCDI
EIVEAHHRHKVDAPSGTAIGMGEAIAGAMGNKLSDVAVYAREGITGERTK
DEIGFATIRAGDIVGEHTAMFADIGERVEITHKATDRMTFANGAVKAAVW
LHEKPAGFYTMTDVLGL

3D structure

• PDB: 5us6 Comparative structural and mechanistic studies of 4-hydroxy-tetrahydrodipicolinate reductases from Mycobacterium tuberculosis and Vibrio vulnificus.
• Chain: J
• Resolution: 2.61 Å

Enzymatic activity

• Enzyme Commision number: 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	J	G8 G11 R12 M13 E34 R35 F75 T76 S80 G98 T100 P123 N124 Y125	G9 G12 R13 M14 E35 R36 F76 T77 S81 G99 T101 P124 N125 Y126
BS02	PDC	J	T100 P123 H156 K159 S164 G165 T166	T101 P124 H157 K160 S165 G166 T167

Gene Ontology

Molecular Function

• GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
• GO:0016491 oxidoreductase activity
• GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5us6, PDBe:5us6, PDBj:5us6
• PDBsum: 5us6
• PubMed: 32980502
• UniProt: Q8DEM0|DAPB_VIBVU 4-hydroxy-tetrahydrodipicolinate reductase (Gene Name=dapB)