Structure of PDB 5t2a Chain J

Receptor sequence

>5t2aJ (length=211) Species: 5661 (Leishmania donovani)

ARRPSRCYRFCKNKPYPKSRFCRGVPDPKIRNFDIGRRRATVDEFPVCIH
VVSRELEQIASEALEAARIQANKYMVKRANKDVFHMRTRAHPFHVLRINK
MLSCAGADRLQTGMRGAFGKPNGVCARVRIGQILLSMRTKEAYVPQAFEA
LRRAKMKFPGRQIIVMSKYWGFTNILRTEYEALRDAGKLEQRGTHCKLIA
PKGKITMRNVM

3D structure

• PDB: 5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
• Chain: J
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	R4 K13 N14 K15 Y17 F22 D35 R39 R40 R90 H92 F94 R98 N100 M115 F119 Q133 R193 G194 H196	R3 K12 N13 K14 Y16 F21 D34 R38 R39 R89 H91 F93 R97 N99 M114 F118 Q132 R192 G193 H195
BS02	rna	J	R3 R4 S6 R7 R10 F22 E63 A64 A67 Q71 K74 R110 G114 M115 R116 F119 R154 M157 K158	R2 R3 S5 R6 R9 F21 E62 A63 A66 Q70 K73 R109 G113 M114 R115 F118 R153 M156 K157
BS03	rna	J	L57 P202 K203 G204 K205 I206 R209	L56 P201 K202 G203 K204 I205 R208

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5t2a, PDBe:5t2a, PDBj:5t2a
• PDBsum: 5t2a
• PubMed: 27752045
• UniProt: A0A3S5H5C4