Structure of PDB 5o9z Chain J |
>5o9zJ (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] |
YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKV KNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKI NWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS |
|
PDB | 5o9z Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation. |
Chain | J |
Resolution | 4.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
J |
G97 G128 |
G95 G126 |
|
|
|
|