Structure of PDB 5ltt Chain J

Receptor sequence

>5lttJ (length=195) Species: 559292 (Saccharomyces cerevisiae S288C)

MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEA
GDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQV
NVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRP
DMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDF

3D structure

• PDB: 5ltt A humanized yeast proteasome identifies unique binding modes of inhibitors for the immunosubunit beta 5i.
• Chain: J
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S18 A20 K34 G48 Y135
• Catalytic site (residue number reindexed from 1): S18 A20 K34 G48 Y135
• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	J	Q118 D120	Q118 D120

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0061133 endopeptidase activator activity

Biological Process

• GO:0010498 proteasomal protein catabolic process
• GO:0010499 proteasomal ubiquitin-independent protein catabolic process
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0000502 proteasome complex
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005789 endoplasmic reticulum membrane
• GO:0005829 cytosol
• GO:0005839 proteasome core complex
• GO:0019774 proteasome core complex, beta-subunit complex

External links

• PDB: RCSB:5ltt, PDBe:5ltt, PDBj:5ltt
• PDBsum: 5ltt
• PubMed: 27789522
• UniProt: P22141|PSB4_YEAST Proteasome subunit beta type-4 (Gene Name=PRE1)