Structure of PDB 5l8r Chain J

Receptor sequence
>5l8rJ (length=42) Species: 3888 (Pisum sativum) [Search protein sequence]
MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF
3D structure
PDB5l8r Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
ChainJ
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA J A11 A14 W18 A11 A14 W18
BS02 CLA J N30 D35 N30 D35
BS03 CLA J A11 P12 T16 F19 A20 A11 P12 T16 F19 A20
BS04 CLA J W18 F19 L22 W18 F19 L22
BS05 CLA J E28 R31 F32 E28 R31 F32
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l8r, PDBe:5l8r, PDBj:5l8r
PDBsum5l8r
PubMed28248295
UniProtD5MAL3

[Back to BioLiP]