Structure of PDB 5jvh Chain J

Receptor sequence

>5jvhJ (length=136) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

• PDB: 5jvh Avilamycin and evernimicin induce structural changes in rProteins uL16 and CTC that enhance the inhibition of A-site tRNA binding.
• Chain: J
• Resolution: 3.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	T8 K9 F10 R11 K12 F14 R15 G16 R17 M18 K23 G24 F30 N46 Q47 Y66 R68 F70 K77 K78 T82 R83 M84 G85 K86 G87 R120 H124 K125 Q129 K131 E140 A141	T3 K4 F5 R6 K7 F9 R10 G11 R12 M13 K18 G19 F25 N41 Q42 Y61 R63 F65 K72 K73 T77 R78 M79 G80 K81 G82 R115 H119 K120 Q124 K126 E135 A136
BS02	rna	J	T19 E39 K99	T14 E34 K94
BS03	6O1	J	I53 S56 R57 R60	I48 S51 R52 R55

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5jvh, PDBe:5jvh, PDBj:5jvh
• PDBsum: 5jvh
• PubMed: 27791159
• UniProt: Q9RXJ5|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)