Structure of PDB 5juy Chain J

Receptor sequence

>5juyJ (length=104) Species: 9913 (Bos taurus)

GDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTD
ANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKK
ATNE

3D structure

• PDB: 5juy A near atomic structure of the active human apoptosome.
• Chain: J
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	J	K13 C14 H18 P30 L32 G41 F46 Y48 T49 N52 W59 K79 M80 I81 L94	K13 C14 H18 P30 L32 G41 F46 Y48 T49 N52 W59 K79 M80 I81 L94

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0006915 apoptotic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:5juy, PDBe:5juy, PDBj:5juy
• PDBsum: 5juy
• PubMed: 27697150
• UniProt: P62894|CYC_BOVIN Cytochrome c (Gene Name=CYCS)