Structure of PDB 5juu Chain J

Receptor sequence

>5juuJ (length=175) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEKLTKKEKKEANLFPEQQNKEIKAERVEDQKVVDKALIAEIKK
TPLLKQYLSASFSLKNGDKPHMLKF

3D structure

PDB

5juu Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	S2 A3 Q4 K5 W9 A17 K19 K20 T21 R22 K23 A24 R26 Q28 K29 A44 G45 R46 F47 K50 D60 N61 T62 F69 K70 N72 G73 P75 R77 R78 V79 N80 R82 Y83 K108 L111 K113 K128 I130 R134 A161 S162 K166 N167	S1 A2 Q3 K4 W8 A16 K18 K19 T20 R21 K22 A23 R25 Q27 K28 A43 G44 R45 F46 K49 D59 N60 T61 F68 K69 N71 G72 P74 R76 R77 V78 N79 R81 Y82 K107 L110 K112 K127 I129 R133 A160 S161 K165 N166

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5juu, PDBe:5juu, PDBj:5juu
PDBsum	5juu
PubMed	27159452
UniProt	Q02326\|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]