Structure of PDB 5jbh Chain J

Receptor sequence

>5jbhJ (length=127) Species: 272844 (Pyrococcus abyssi GE5)

MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYG
GNRKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAI
IETEIGKAKVTSRPGQDGVVNAILLEE

3D structure

• PDB: 5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
• Chain: J
• Resolution: 5.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	M1 W4 Q5 R7 L9 K11 S13 G14 I17 A20 R21 K22 K23 K25 R26 E27 L28 G29 R30 P32 R43 R47 T48 Y49 G50 R56 F66 S69 K71 G72 R73 K74 P84 A85 N86 K97 G98 T111 R113 G115 Q116 V119	M1 W4 Q5 R7 L9 K11 S13 G14 I17 A20 R21 K22 K23 K25 R26 E27 L28 G29 R30 P32 R43 R47 T48 Y49 G50 R56 F66 S69 K71 G72 R73 K74 P84 A85 N86 K97 G98 T111 R113 G115 Q116 V119

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
• PDBsum: 5jbh
• PubMed: 27819266
• UniProt: Q8U1Y5|RS8E_PYRFU Small ribosomal subunit protein eS8 (Gene Name=rps8e)