Structure of PDB 5j0n Chain J

Receptor sequence
>5j0nJ (length=94) Species: 562 (Escherichia coli) [Search protein sequence]
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGS
FSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG
3D structure
PDB5j0n Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
ChainJ
Resolution11.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J R46 H54 R56 R59 P64 R46 H54 R56 R59 P64
BS02 dna J T2 K3 S4 R42 E44 R46 S50 R59 G61 R62 N63 P64 V70 L72 G83 K84 T2 K3 S4 R42 E44 R46 S50 R59 G61 R62 N63 P64 V70 L72 G83 K84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5j0n, PDBe:5j0n, PDBj:5j0n
PDBsum5j0n
PubMed27223329
UniProtP0A6Y1|IHFB_ECOLI Integration host factor subunit beta (Gene Name=ihfB)

[Back to BioLiP]