Structure of PDB 5iyd Chain J

Receptor sequence
>5iydJ (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL
AHVDLIEKLLNYAPLEK
3D structure
PDB5iyd Near-atomic resolution visualization of human transcription promoter opening.
ChainJ
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN J I13 V14 I13 V14
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001055 RNA polymerase II activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006356 regulation of transcription by RNA polymerase I
GO:0006360 transcription by RNA polymerase I
GO:0006366 transcription by RNA polymerase II
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005665 RNA polymerase II, core complex
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iyd, PDBe:5iyd, PDBj:5iyd
PDBsum5iyd
PubMed27193682
UniProtP62875|RPAB5_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC5 (Gene Name=POLR2L)

[Back to BioLiP]