Structure of PDB 5hkv Chain J

Receptor sequence
>5hkvJ (length=137) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
LLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESAR
IAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPGR
ILFEVAGVSEEVAREALRLASHKLPVKTKFVKREELG
3D structure
PDB5hkv Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
ChainJ
Resolution3.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R11 H13 P15 K16 F29 W41 Q46 S49 W65 F69 H71 R82 M83 G84 G86 K87 R101 R119 H123 K124 P126 K128 R10 H12 P14 K15 F28 W40 Q45 S48 W64 F68 H70 R81 M82 G83 G85 K86 R100 R118 H122 K123 P125 K127
BS02 rna J R20 T39 R19 T38
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkv, PDBe:5hkv, PDBj:5hkv
PDBsum5hkv
PubMed28973455
UniProtQ2FW13|RL16_STAA8 Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]