Structure of PDB 5gm6 Chain J

Receptor sequence
>5gm6J (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SRHQFDLIMCLKQPGVQTGLLCEKCDGKCPICDSYVRPKRKVRVCENCSF
GKQAKNCIICNLNVGVNDAFYCWECCRLGKDKDGCPRILNLGSNRLDRHF
EKK
3D structure
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
ChainJ
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J S94 N95 R99 S93 N94 R98
BS02 rna J H4 K25 G52 N95 K103 H3 K24 G51 N94 K102
BS03 ZN J C11 C49 C86 C10 C48 C85
BS04 ZN J C26 C58 C25 C57
BS05 ZN J C30 C33 C73 C76 C29 C32 C72 C75
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0009410 response to xenobiotic stimulus
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtQ06835|RDS3_YEAST Pre-mRNA-splicing factor RDS3 (Gene Name=RDS3)

[Back to BioLiP]