Structure of PDB 5gaf Chain J

Receptor sequence
>5gafJ (length=134) Species: 562 (Escherichia coli) [Search protein sequence]
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPV
VITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQ
EIAQTKAADMTGADIEAMTRSIEGTARSMGLVVE
3D structure
PDB5gaf Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon
ChainJ
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J K10 Q12 P75 A76 A77 S88 G89 S90 G91 K92 P93 N94 K95 K113 M117 T118 G119 R127 S128 G131 T132 R134 S135 M136 K3 Q5 P68 A69 A70 S81 G82 S83 G84 K85 P86 N87 K88 K106 M110 T111 G112 R120 S121 G124 T125 R127 S128 M129
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
GO:0015968 stringent response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gaf, PDBe:5gaf, PDBj:5gaf
PDBsum5gaf
PubMed26804923
UniProtP0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]