Structure of PDB 5ef6 Chain J

Receptor sequence
>5ef6J (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQN
RRVKEKKVLAKV
3D structure
PDB5ef6 Impact of cytosine methylation on DNA binding specificities of human transcription factors.
ChainJ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna J T242 K243 T26 K27
BS02 dna J R217 R220 I221 P222 Y223 Q259 I262 N266 K270 R1 R4 I5 P6 Y7 Q43 I46 N50 K54
BS03 dna J R220 P222 F240 K243 R246 Q265 R268 R4 P6 F24 K27 R30 Q49 R52
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ef6, PDBe:5ef6, PDBj:5ef6
PDBsum5ef6
PubMed28473536
UniProtQ92826|HXB13_HUMAN Homeobox protein Hox-B13 (Gene Name=HOXB13)

[Back to BioLiP]