Structure of PDB 5bkn Chain J |
>5bknJ (length=144) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] |
NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN |
|
PDB | 5bkn Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts. |
Chain | J |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
J |
N16 S17 |
N1 S2 |
|
BS02 |
MG |
J |
T82 S92 |
T67 S77 |
|
|
|
|