Structure of PDB 5apn Chain J

Receptor sequence

>5apnJ (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

5apn Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

Chain

Resolution

3.91 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K16 V18 N20 S22 R51 Y52 T56 F57 H68 N95 F96 S97 A98 T99 G103 F104 G105 I106 D107 G124 D126 Y128 K142	K11 V13 N15 S17 R46 Y47 T51 F52 H63 N90 F91 S92 A93 T94 G98 F99 G100 I101 D102 G119 D121 Y123 K137
BS02	rna	J	M9 Q43 T44 V46 T70 R72 G135 R137 R141 R143 G149 S151	M4 Q38 T39 V41 T65 R67 G130 R132 R136 R138 G144 S146

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5apn, PDBe:5apn, PDBj:5apn
PDBsum	5apn
PubMed	26709046
UniProt	P0C0W9\|RL11A_YEAST Large ribosomal subunit protein uL5A (Gene Name=RPL11A)

[Back to BioLiP]