Structure of PDB 5anc Chain J

Receptor sequence

>5ancJ (length=250) Species: 9606 (Homo sapiens)

MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEV
LQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKER
HTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKST
KQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESE
DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

3D structure

• PDB: 5anc Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
• Chain: J
• Resolution: 4.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	M1 S2 I3 F4 T5 P6 Q9 I10 R11 L12 T13 R19 K21 S61 K62 G63 Q64 V65 K68 Q94 V95 R100 H141 K145 N147 S149 K151 Q152 L155 C216 E219 K240	M1 S2 I3 F4 T5 P6 Q9 I10 R11 L12 T13 R19 K21 S61 K62 G63 Q64 V65 K68 Q94 V95 R100 H141 K145 N147 S149 K151 Q152 L155 C216 E219 K240

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008017 microtubule binding
• GO:0019843 rRNA binding
• GO:0043022 ribosome binding

Biological Process

• GO:0001833 inner cell mass cell proliferation
• GO:0002244 hematopoietic progenitor cell differentiation
• GO:0006364 rRNA processing
• GO:0007052 mitotic spindle organization
• GO:0030282 bone mineralization
• GO:0030595 leukocyte chemotaxis
• GO:0042254 ribosome biogenesis
• GO:0042256 cytosolic ribosome assembly
• GO:0048539 bone marrow development

Cellular Component

• GO:0000922 spindle pole
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005819 spindle
• GO:0005829 cytosol
• GO:0005856 cytoskeleton

External links

• PDB: RCSB:5anc, PDBe:5anc, PDBj:5anc
• PDBsum: 5anc
• PubMed: 26479198
• UniProt: Q9Y3A5|SBDS_HUMAN Ribosome maturation protein SBDS (Gene Name=SBDS)