Structure of PDB 4wfn Chain J

Receptor sequence

>4wfnJ (length=136) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

PDB

4wfn The Ribosomal Protein uL22 Modulates the Shape of the Protein Exit Tunnel.

Chain

Resolution

3.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K9 F10 K12 F14 R15 G16 R17 M18 D21 K23 G24 G25 F30 W42 N46 Q47 R57 Y66 F70 T76 K77 K78 E81 T82 R83 M84 G85 K86 G87 L121 H124 K125 E140	K4 F5 K7 F9 R10 G11 R12 M13 D16 K18 G19 G20 F25 W37 N41 Q42 R52 Y61 F65 T71 K72 K73 E76 T77 R78 M79 G80 K81 G82 L116 H119 K120 E135
BS02	rna	J	T19 D21 E39 K99	T14 D16 E34 K94

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4wfn, PDBe:4wfn, PDBj:4wfn
PDBsum	4wfn
PubMed	28689968
UniProt	Q9RXJ5\|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)