Structure of PDB 4tma Chain J |
>4tmaJ (length=57) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
ETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEKRIPSSGS DDWSEEP |
|
PDB | 4tma Direct control of type IIA topoisomerase activity by a chromosomally encoded regulatory protein. |
Chain | J |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
J |
C9 C12 C28 C32 |
C7 C10 C26 C30 |
|
|
|
|