Structure of PDB 4qyz Chain J

Receptor sequence
>4qyzJ (length=195) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MRSYLILRLAGPMQAWGQPTGTRPTGRFPTRSGLLGLLGACLGIQRDDTS
SLQALSESVQFAVRCDELILRRVSVTGLRDYHTVLIQTWREYLCDASFTV
ALWLTPHATMVISELEKAVLKPRYTPYLGRRSCPLTHPLFLGTCQPQKAL
LNYEPVGGDIYSEESVHLKFTARDEPMITLPRQFASREWYVIKGG
3D structure
PDB4qyz Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
ChainJ
Resolution3.0303 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J G17 Q18 P19 R25 S34 G35 G38 L39 A42 I46 Q47 R48 Y85 H86 T87 R108 Y142 P144 Y145 G147 R148 R149 R197 R206 F208 G17 Q18 P19 R23 S32 G33 G36 L37 A40 I44 Q45 R46 Y81 H82 T83 R90 Y124 P126 Y127 G129 R130 R131 R173 R182 F184
BS02 dna J I104 Q105 I86 Q87
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qyz, PDBe:4qyz, PDBj:4qyz
PDBsum4qyz
PubMed25123481
UniProtQ46898|CAS5_ECOLI CRISPR system Cascade subunit CasD (Gene Name=casD)

[Back to BioLiP]