Structure of PDB 4dr1 Chain J

Receptor sequence

>4dr1J (length=98) Species: 300852 (Thermus thermophilus HB8)

KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRG
PFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT

3D structure

• PDB: 4dr1 A structural basis for streptomycin-induced misreading of the genetic code.
• Chain: J
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	R5 K7 H13 S35 P37 P39 L40 P41 T42 V44 R45 T48 R51 G52 P53 F54 K55 H56 K57 R60 H62 H68 R70 D73	R3 K5 H11 S33 P35 P37 L38 P39 T40 V42 R43 T46 R49 G50 P51 F52 K53 H54 K55 R58 H60 H66 R68 D71

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4dr1, PDBe:4dr1, PDBj:4dr1
• PDBsum: 4dr1
• PubMed: 23322043
• UniProt: Q5SHN7|RS10_THET8 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)