Structure of PDB 4cqm Chain J

Receptor sequence
>4cqmJ (length=240) Species: 9606 (Homo sapiens) [Search protein sequence]
HHHMDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLG
GDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKT
EDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSV
YSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKN
IPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
3D structure
PDB4cqm Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
ChainJ
Resolution2.339 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G13 S135 Q145 Y148 K152
Catalytic site (residue number reindexed from 1) G16 S138 Q148 Y151 K155
Enzyme Commision number 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
1.6.5.10: NADPH dehydrogenase (quinone).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP J G9 S11 R12 I14 A33 R34 D56 V57 A83 A84 G85 I86 V133 S135 Y148 K152 P178 V181 T183 M185 G12 S14 R15 I17 A36 R37 D59 V60 A86 A87 G88 I89 V136 S138 Y151 K155 P181 V184 T186 M188 MOAD: Kd=26.8uM
Gene Ontology
Molecular Function
GO:0003955 NAD(P)H dehydrogenase (quinone) activity
GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0005515 protein binding
GO:0008753 NADPH dehydrogenase (quinone) activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0048038 quinone binding
GO:0070402 NADPH binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0044597 daunorubicin metabolic process
GO:0044598 doxorubicin metabolic process
GO:0046949 fatty-acyl-CoA biosynthetic process
GO:0051289 protein homotetramerization
GO:0051290 protein heterotetramerization
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:1990204 oxidoreductase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cqm, PDBe:4cqm, PDBj:4cqm
PDBsum4cqm
PubMed25203508
UniProtQ8N4T8|CBR4_HUMAN 3-oxoacyl-[acyl-carrier-protein] reductase (Gene Name=CBR4)

[Back to BioLiP]