Structure of PDB 3wut Chain J

Receptor sequence
>3wutJ (length=44) Species: 9606 (Homo sapiens) [Search protein sequence]
HEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTET
3D structure
PDB3wut Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells.
ChainJ
Resolution2.301 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide J A177 K180 Q183 W184 Y187 Q190 R191 Y194 A10 K13 Q16 W17 Y20 Q23 R24 Y27
Gene Ontology
Biological Process
GO:0000281 mitotic cytokinesis
GO:0051896 regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

View graph for
Biological Process
External links
PDB RCSB:3wut, PDBe:3wut, PDBj:3wut
PDBsum3wut
PubMed26392564
UniProtQ53EZ4|CEP55_HUMAN Centrosomal protein of 55 kDa (Gene Name=CEP55)

[Back to BioLiP]