Structure of PDB 3v6k Chain J

Receptor sequence

>3v6kJ (length=333) Species: 273057 (Saccharolobus solfataricus P2)

MIFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARK
FGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIEIA
SIDEAYLDDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMA
KPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSI
EFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVTMKRNSRNL
EEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISK
ETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

• PDB: 3v6k Replication of n(2) ,3-ethenoguanine by DNA polymerases.
• Chain: J
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	J	E106 G185 I186 G187 I189 T190 V296 S297 R298 G299 R300 T301 K339	E104 G177 I178 G179 I181 T182 V288 S289 R290 G291 R292 T293 K331
BS02	dna	J	V32 S34 G41 A42 A220 R242 K243 S244 I245 G246 R247 I248 T250 L293 R332 R336	V30 S32 G39 A40 A212 R234 K235 S236 I237 G238 R239 I240 T242 L285 R324 R328
BS03	CA	J	A181 D182 I186	A173 D174 I178
BS04	MG	J	D7 F8 D105	D5 F6 D103
BS05	CA	J	S103 I104	S101 I102

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3v6k, PDBe:3v6k, PDBj:3v6k
• PDBsum: 3v6k
• PubMed: 22488769
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)