Structure of PDB 3v6j Chain J

Receptor sequence

>3v6jJ (length=343) Species: 273057 (Saccharolobus solfataricus P2)

HMIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYE
ARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKI
EIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKV
FAKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGI
NKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIV
TMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRG
RTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 3v6j Replication of n(2) ,3-ethenoguanine by DNA polymerases.
• Chain: J
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	J	G185 G187 I189 T190 V296 S297 R298 G299 K321	G186 G188 I190 T191 V297 S298 R299 G300 K322
BS02	dna	J	V32 S34 F37 G41 A220 R242 K243 S244 G246 R247 T250 L293 R331 R332 R336	V33 S35 F38 G42 A221 R243 K244 S245 G247 R248 T251 L294 R332 R333 R337
BS03	DCP	J	D7 F8 Y10 T45 R51 D105 K159	D8 F9 Y11 T46 R52 D106 K160
BS04	MG	J	D7 D105 E106	D8 D106 E107
BS05	MG	J	D7 F8 D105	D8 F9 D106

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3v6j, PDBe:3v6j, PDBj:3v6j
• PDBsum: 3v6j
• PubMed: 22488769
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)