Structure of PDB 3siv Chain J

Receptor sequence

>3sivJ (length=126) Species: 9606 (Homo sapiens)

EADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISE
FIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIAC
SVTIKEGSQLKQQIQSIQQSIERLLV

3D structure

• PDB: 3siv Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
• Chain: J
• Resolution: 3.304 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	H17 K21 S122 R125	H15 K19 S120 R123
BS02	rna	J	K37 G38 A39 N40 E41 A60 E61 I65 S96 R97 V99 I100	K35 G36 A37 N38 E39 A58 E59 I63 S94 R95 V97 I98
BS03	rna	J	E41 K44 R48	E39 K42 R46

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0030621 U4 snRNA binding
• GO:0030622 U4atac snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0034512 box C/D sno(s)RNA binding
• GO:0051117 ATPase binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000492 box C/D snoRNP assembly
• GO:0006397 mRNA processing
• GO:0007338 single fertilization
• GO:0008380 RNA splicing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0001651 dense fibrillar component
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005690 U4atac snRNP
• GO:0005730 nucleolus
• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3siv, PDBe:3siv, PDBj:3siv
• PDBsum: 3siv
• PubMed: 21784869
• UniProt: P55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)