Structure of PDB 3s2h Chain J

Receptor sequence

>3s2hJ (length=65) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMI
LTHVDLIEKFLRYNP

3D structure

PDB

3s2h Initiation complex structure and promoter proofreading.

Chain

Resolution

3.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	J	C7 C10 C46	C7 C10 C46

Gene Ontology

	Molecular Function
GO:0001054	RNA polymerase I activity
GO:0001055	RNA polymerase II activity
GO:0001056	RNA polymerase III activity
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0003968	RNA-dependent RNA polymerase activity
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0001172	RNA-templated transcription
GO:0006351	DNA-templated transcription
GO:0006360	transcription by RNA polymerase I
GO:0006361	transcription initiation at RNA polymerase I promoter
GO:0006362	transcription elongation by RNA polymerase I
GO:0006363	termination of RNA polymerase I transcription
GO:0006366	transcription by RNA polymerase II
GO:0006367	transcription initiation at RNA polymerase II promoter
GO:0006368	transcription elongation by RNA polymerase II
GO:0006383	transcription by RNA polymerase III
GO:0006384	transcription initiation at RNA polymerase III promoter
GO:0006386	termination of RNA polymerase III transcription
GO:0042254	ribosome biogenesis
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0042797	tRNA transcription by RNA polymerase III

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005665	RNA polymerase II, core complex
GO:0005666	RNA polymerase III complex
GO:0005730	nucleolus
GO:0005736	RNA polymerase I complex

External links

PDB	RCSB:3s2h, PDBe:3s2h, PDBj:3s2h
PDBsum	3s2h
PubMed	21798951
UniProt	P22139\|RPAB5_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC5 (Gene Name=RPB10)