Structure of PDB 3pio Chain J

Receptor sequence

>3pioJ (length=136) Species: 1299 (Deinococcus radiodurans)

KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVM
SRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMF
EVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA

3D structure

• PDB: 3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
• Chain: J
• Resolution: 3.2473 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K9 F10 R11 K12 Q13 F14 R15 G16 R17 M18 K23 G24 F30 N46 Q47 R60 R68 F70 K77 K78 E81 T82 R83 M84 K86 G87 K88 H124 K125 P127 Q129	K4 F5 R6 K7 Q8 F9 R10 G11 R12 M13 K18 G19 F25 N41 Q42 R55 R63 F65 K72 K73 E76 T77 R78 M79 K81 G82 K83 H119 K120 P122 Q124
BS02	rna	J	T19 D21 E39 P40 K99	T14 D16 E34 P35 K94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3pio, PDBe:3pio, PDBj:3pio
• PDBsum: 3pio
• PubMed: 21282615
• UniProt: Q9RXJ5|RL16_DEIRA Large ribosomal subunit protein uL16 (Gene Name=rplP)