Structure of PDB 3jam Chain J

Receptor sequence

>3jamJ (length=182) Species: 28985 (Kluyveromyces lactis)

PRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLE
SEKHIDFARTSPFGGARPGRVARKRAAAAGGE

3D structure

• PDB: 3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
• Chain: J
• Resolution: 3.46 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	P2 R3 P5 R6 T7 Y8 S9 K10 T11 Y12 T14 R17 P18 Y19 L24 K37 N38 K39 R40 R44 R54 F71 E72 A75 R79 R82 S121 H124 R126 V127 Q131 R132 H133 Q139 N142 I143 P144 S145 F146 M147 R149 S152 P163 F164 R168 P169 R171 V172 A173 R174 K175 R176	P1 R2 P4 R5 T6 Y7 S8 K9 T10 Y11 T13 R16 P17 Y18 L23 K36 N37 K38 R39 R43 R53 F70 E71 A74 R78 R81 S120 H123 R125 V126 Q130 R131 H132 Q138 N141 I142 P143 S144 F145 M146 R148 S151 P162 F163 R167 P168 R170 V171 A172 R173 K174 R175

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0043226 organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jam, PDBe:3jam, PDBj:3jam
• PDBsum: 3jam
• PubMed: 26212456
• UniProt: Q6CM18