Structure of PDB 3j81 Chain J

Receptor sequence

>3j81J (length=182) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]

PRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRISFQLSK
IRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKV
EDFLERRLQTQVYKLGLAKSVHHARVLISQRHIAVGKQIVNIPSFMVRLE
SEKHIDFARTSPFGGARPGRVARKRAAAAGGE

3D structure

PDB

3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	P2 R3 A4 P5 R6 T7 Y8 S9 K10 T11 Y12 S13 T14 K16 R17 P18 Y19 L24 K37 N38 K39 R40 R44 K51 R54 R79 R82 S121 H123 H124 R126 V127 Q131 R132 H133 Q139 V141 N142 I143 P144 S145 F146 R149 R168 G170 R171 V172 A173 K175 R176	P1 R2 A3 P4 R5 T6 Y7 S8 K9 T10 Y11 S12 T13 K15 R16 P17 Y18 L23 K36 N37 K38 R39 R43 K50 R53 R78 R81 S120 H122 H123 R125 V126 Q130 R131 H132 Q138 V140 N141 I142 P143 S144 F145 R148 R167 G169 R170 V171 A172 K174 R175

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0043226	organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j81, PDBe:3j81, PDBj:3j81
PDBsum	3j81
PubMed	25417110
UniProt	Q6CM18

[Back to BioLiP]