Structure of PDB 3j7y Chain J

Receptor sequence
>3j7yJ (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLP
TKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHV
YEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK
3D structure
PDB3j7y Structure of the large ribosomal subunit from human mitochondria.
ChainJ
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna J R21 I23 Q41 R42 T86 S88 G100 R102 T104 A129 F130 D134 S139 R142 S143 G146 S147 S150 L151 R4 I6 Q24 R25 T69 S71 G83 R85 T87 A112 F113 D117 S122 R125 S126 G129 S130 S133 L134
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7y, PDBe:3j7y, PDBj:3j7y
PDBsum3j7y
PubMed25278503
UniProtQ9Y3B7|RM11_HUMAN Large ribosomal subunit protein uL11m (Gene Name=MRPL11)

[Back to BioLiP]