Structure of PDB 3j1o Chain J

Receptor sequence

>3j1oJ (length=159) Species: 4932 (Saccharomyces cerevisiae)

PGQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVS
VTSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKY
VRETSGVTTALLKDEEIEKLLQQDREITNWARTTFRNEYGKHDPFNVDDV
LKFTFTGEK

3D structure

• PDB: 3j1o Interaction of the mediator head module with RNA polymerase II.
• Chain: J
• Resolution: 16.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	J	D91 V94 K117 N118	D63 V66 K89 N90

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0003677 DNA binding
• GO:0003712 transcription coregulator activity
• GO:0003714 transcription corepressor activity
• GO:0005515 protein binding
• GO:0017025 TBP-class protein binding
• GO:0030674 protein-macromolecule adaptor activity

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0032968 positive regulation of transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0016592 mediator complex
• GO:0070847 core mediator complex

External links

• PDB: RCSB:3j1o, PDBe:3j1o, PDBj:3j1o
• PDBsum: 3j1o
• PubMed: 22579255
• UniProt: P38304|MED8_YEAST Mediator of RNA polymerase II transcription subunit 8 (Gene Name=MED8)